Rabbit Anti-IL21 Receptor Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21153P

• Product Name:
• Rabbit Anti-IL21 Receptor Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF , corresponding to N-term aa 35-65 of Mouse IL21 Receptor.

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• ELISA, Flow Cyt, IHC-P

• Storage Buffer:
• Preservative: 0.1% Sodium Azide Constituents: PBS, pH 7.2

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid