Cat#:FPA-21137P;Product Name:Rabbit Anti-IL20 Receptor alpha Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human IL20 Receptor alpha aa 135-171 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: TQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVS ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human IL20 Receptor alpha aa 135-171 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: TQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVS