• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-IL18 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-21081P
  • Product Name:
  • Rabbit Anti-IL18 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant full length protein corresponding to Human IL18 aa 37-193. immunogen corresponding to mature protein (aa 37-193) of Human IL18. Sequence: YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIIS MYKDSQPRGM AVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSD IIFF
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • ICC, WB, IHC-P
  • Storage Buffer:
  • Preservative: 0.025% Sodium azide Constituents: 2.5% BSA, 0.45% Sodium chloride, 0.1% Dibasic monohydrogen sodium phosphate
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-IL18 Polyclonal Antibody-FPA-21080P
  • Online Inquiry

    refresh