Rabbit Anti-IL18 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21081P

• Product Name:
• Rabbit Anti-IL18 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Human IL18 aa 37-193. immunogen corresponding to mature protein (aa 37-193) of Human IL18. Sequence: YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIIS MYKDSQPRGM AVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSD IIFF

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• ICC, WB, IHC-P

• Storage Buffer:
• Preservative: 0.025% Sodium azide Constituents: 2.5% BSA, 0.45% Sodium chloride, 0.1% Dibasic monohydrogen sodium phosphate

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid