Cat#:FPA-21072P;Product Name:Rabbit Anti-IL17RD Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human IL17RD aa 62-132. Sequence: NCSTYLNPVGKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGF RVILEELKSEGRQCQQLILKD ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:ICC/IF, IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;