• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-IL17B Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-21048P
  • Product Name:
  • Rabbit Anti-IL17B Polyclonal Antibody
  • Formulation:
  • Lyophilised:Centrifuge vial prior to opening. Reconstitute in sterile water to a concentration of 0.1-1.0 mg/ml.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant full length protein corresponding to Human IL17B aa 21-180. Highly pure (>98%); E coli derived mature protein Sequence: QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMV AQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR CLCLGCVNPFTMQEDRSMVSV
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Hamster
  • Isotype:
  • IgG
  • Application:
  • WB, Sandwich ELISA
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Pre product:Rabbit Anti-IL17A Receptor Polyclonal Antibody-FPA-21047P
  • Online Inquiry

    refresh