Rabbit Anti-IL10 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-20955P

• Product Name:
• Rabbit Anti-IL10 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Mouse IL10 aa 19-178. The immunogen sequence corresponds to the mature protein and is expressed in E.coli. The signal peptide aa 1-18 are excluded. Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILL

• Species Reactivity:
• Predicted to work with: Mouse, Rat, Guinea pig

• Isotype:
• IgG

• Application:
• ELISA, WB

• Storage Buffer:
• Preservative: 0.025% Sodium azide Constituents: 0.45% Sodium chloride, 0.1% Dibasic monohydrogen sodium phosphate

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid