• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-IKZF3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-20908P
  • Product Name:
  • Rabbit Anti-IKZF3 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide, corresponding to a region within the aa 350-400 ( EMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNH I ) of Human IKZF3.
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Monkey
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P
  • Storage Buffer:
  • Preservative: 0.05% Sodium azide Constituents: 99% PBS, 0.05% BSA
  • Storage Procedures:
  • Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles. Store undiluted.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-IKZF3 Polyclonal Antibody-FPA-20907P
  • Online Inquiry

    refresh