Rabbit Anti-IDH2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-20584P

• Product Name:
• Rabbit Anti-IDH2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal sequence aa 143-192 (GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTF K) of Human IDH2 (NP_002159)

• Species Reactivity:
• Human, Zebrafish Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae, Caenorhabditis elegans

• Isotype:
• IgG

• Application:
• IHC-P, WB, ICC/IF

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid