• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-hunchback Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-47204P
  • Product Name:
  • Rabbit Anti-hunchback Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within N-terminal aa 1-50 (MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPI P) of Human hunchback (NP_731268). Run BLAST with Run BLAST with
  • Species Reactivity:
  • Drosophila melanogaster Predicted to work with: Rat
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Human Serum Albumin Polyclonal Antibody-FPA-47203P
  • Online Inquiry

    refresh