Rabbit Anti-Human GCG Antibody Online Inquiry

• Cat#:
• PA-2766F

• Product Name:
• Rabbit Anti-Human GCG Antibody

• Synonym:
• GCG; glucagon; GLP1; GLP2; GRPP

• Gene Introduction:
• Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.

• Description:
• Rabbit Anti-Human GCG Polyclonal Antibody

• Host Species:
• Rabbit

• Species Reactivity:
• Human

• Application:
• RIA

• Usage:
• For Lab Research Use Only

• Storage:
• Store antibody products at 2-8°C. For long term storage, aliquot and freeze at -20°C. Avoid repeated freeze/thaw cycles

• Clonality:
• Polyclonal

• Form:
• Liquid