Cat#:FPA-20172P;Product Name:Rabbit Anti-HSD3B7 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human HSD3B7 aa 121-170. NP_079469.2 Sequence: TRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLV ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:WB, ELISA, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;