Rabbit Anti-HOXC8 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-19974P

• Product Name:
• Rabbit Anti-HOXC8 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the N terminal aa 36-85 of Human HOXC8 ( HALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDA ) NP_073149

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Horse, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• ICC/IF, IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid