Rabbit Anti-HORMAD1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47156P

• Product Name:
• Rabbit Anti-HORMAD1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human HORMAD1 aa 256-323. Numbering is from isoform 1; the same sequence occurs in isoforms 2, 3, 4 and 5. Sequence: DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSK ESPDLSISHSQVEQLVNK Database link: Q86X24 Run BLAS

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• ICC/IF

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid