Cat#:FPA-19731P;Product Name:Rabbit Anti-HMGCS2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human HMGCS2 aa 478-508 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: PPGDTNSLFPGTWYLERVDEQHRRKYARRPV ;Species Reactivity:Human;Isotype:IgG;Application:IHC-P, Flow Cyt, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide corresponding to Human HMGCS2 aa 478-508 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: PPGDTNSLFPGTWYLERVDEQHRRKYARRPV