Rabbit Anti-HMGCLL1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-19716P

• Product Name:
• Rabbit Anti-HMGCLL1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 2-51 ( GNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIV ) of Human HMGCLL1 (NP_001035865).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at -20°C. Stable for 12 months at -20°C.

• Clonality:
• Polyclonal

• Form:
• Liquid