Rabbit Anti-Histone H2B (testis specific) (acetyl K126) Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-19349P

• Product Name:
• Rabbit Anti-Histone H2B (testis specific) (acetyl K126) Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Histone H2B (testis specific) aa 78-127 (C terminal) (acetyl K126). The exact sequence is proprietary. Sequence: EASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS without Mg2+ and Ca2+.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid