Cat#:FPA-19244P;Product Name:Rabbit Anti-Histidase Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within the N terminal aa 180-229 ( INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET ) of Human Histidase (NP_002099) ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within the N terminal aa 180-229 ( INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET ) of Human Histidase (NP_002099)
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
Isotype:
IgG
Application:
WB, IHC-P
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.