Rabbit Anti-Hemoglobin subunit epsilon Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18961P

• Product Name:
• Rabbit Anti-Hemoglobin subunit epsilon Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide derived from a region within N terminal aa 1-50 ( MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS ) of Rat Hemoglobin subunit epsilon.

• Species Reactivity:
• Rat Predicted to work with: Mouse, Sheep, Rabbit, Goat, Horse, Cow, Cat, Dog, Human, Pig, African green monkey, Spider monkey

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid