Rabbit Anti-hCG Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18740P

• Product Name:
• Rabbit Anti-hCG Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• This product was produced with the following immunogens: Full length native protein (purified) corresponding to Pig hCG aa 25-120. Sequence: FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKT MLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS

• Species Reactivity:
• Pig Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Hamster, Cow, Cat, Dog

• Isotype:
• IgG

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid