• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-hCG Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-18740P
  • Product Name:
  • Rabbit Anti-hCG Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • This product was produced with the following immunogens: Full length native protein (purified) corresponding to Pig hCG aa 25-120. Sequence: FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKT MLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
  • Species Reactivity:
  • Pig Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Hamster, Cow, Cat, Dog
  • Isotype:
  • IgG
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituent: 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-hCG Polyclonal Antibody-FPA-18739P
  • Online Inquiry

    refresh