Rabbit Anti-HBXIP Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18710P

• Product Name:
• Rabbit Anti-HBXIP Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human HBXIP aa 43-92 (N terminal). The immunogen for this antibody uses the NP_006393.2 sequence and not the UniProt O43504.1 sequence. Sequence: FVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLE

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid