Rabbit Anti-H6PD Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18590P

• Product Name:
• Rabbit Anti-H6PD Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within N terminal aa 179-228 (HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGL W) of Human H6PD NP_0042760

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid