• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-H2A Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-18586P
  • Product Name:
  • Rabbit Anti-H2A Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human H2A aa 13-62 (N terminal). Immunogen sequence is located with the aa region of 13-62 of Q9BTM1 Sequence: AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 97% PBS, 2% Sucrose
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-H1N1 Influenza A virus Nucleocapsid protein Polyclonal Antibody-FPA-18585P
  • Online Inquiry

    refresh