Rabbit Anti-GXYLT1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47029P

• Product Name:
• Rabbit Anti-GXYLT1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human GXYLT1 aa 332-381 (C terminal). The exact sequence is proprietary. NP_775872 Sequence: LFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAV Database link: Q4G148 Run BLAST with Run BLAST with

• Species Reactivity:
• Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid