Rabbit Anti-Guanylyl Cyclase beta 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18569P

• Product Name:
• Rabbit Anti-Guanylyl Cyclase beta 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Guanylyl Cyclase beta 1 aa 10-59. NP_000848.1 Sequence: ELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA, IHC-P

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol (PBS is without Mg2+ and Ca2+)

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid