Cat#:FPA-18532P;Product Name:Rabbit Anti-GTPBP1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human GTPBP1 aa 575-625. The exact sequence is proprietary. NP_004277.2 Sequence: QTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASS V ;Species Reactivity:Human Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human GTPBP1 aa 575-625. The exact sequence is proprietary. NP_004277.2 Sequence: QTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASS V
Species Reactivity:
Human Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan
Isotype:
IgG
Application:
IP, WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.