Cat#:FPA-18453P;Product Name:Rabbit Anti-GSTA3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Fusion protein corresponding to Human GSTA3 aa 1-222. Full length fusion protein. The identity of the protein fusion partner is GST Sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMA DLNEMILLLPL;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 49% PBS, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Fusion protein corresponding to Human GSTA3 aa 1-222. Full length fusion protein. The identity of the protein fusion partner is GST Sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMA DLNEMILLLPL