Rabbit Anti-Growth hormone receptor Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18333P

• Product Name:
• Rabbit Anti-Growth hormone receptor Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Growth hormone receptor aa 218-267 (C terminal). The exact sequence is proprietary. (NP_001229391) Sequence: YSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPW

• Species Reactivity:
• Predicted to work with: Human

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid