• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-GRIK5 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-18269P
  • Product Name:
  • Rabbit Anti-GRIK5 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within internal sequence aa 468-517 of Human GRIK5 ( EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM )
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Chimpanzee, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • IHC-P, WB
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-GRIK5 Polyclonal Antibody-FPA-18268P
  • Online Inquiry

    refresh