Rabbit Anti-GREM2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-18239P

• Product Name:
• Rabbit Anti-GREM2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human GREM2 aa 107-168 (C terminal). The exact sequence is proprietary. Sequence: PRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCR CMSVNLSDSDKQ

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• ELISA, IHC-P

• Storage Buffer:
• pH: 7 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 10% Glycerol, 89% Tris glycine

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid