Rabbit Anti-GPCR GPR87 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-17934P

• Product Name:
• Rabbit Anti-GPCR GPR87 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 1-50 ( MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLY L) of Human GPCR GPR87 (NP_076404).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid