Cat#:FPA-17884P;Product Name:Rabbit Anti-GPCR GPR55 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human GPCR GPR55 aa 245-319 (C terminal). The exact sequence is proprietary. Sequence: GFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKE FRMNIRAHRPSRVQLVLQDTTISRG ;Species Reactivity:Human;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 49% PBS, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human GPCR GPR55 aa 245-319 (C terminal). The exact sequence is proprietary. Sequence: GFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKE FRMNIRAHRPSRVQLVLQDTTISRG