Rabbit Anti-GPCR GPR141 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-17785P

• Product Name:
• Rabbit Anti-GPCR GPR141 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human GPCR GPR141 aa 122-171 (internal sequence). The exact sequence is proprietary. (NP_861456). Sequence: DKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHK

• Species Reactivity:
• Human Predicted to work with: Rabbit

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid