Cat#:FPA-17698P;Product Name:Rabbit Anti-GPATCH2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Mouse GPATCH2 aa 73-122 (N terminal). The exact sequence is proprietary. Sequence: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV ;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Mouse GPATCH2 aa 73-122 (N terminal). The exact sequence is proprietary. Sequence: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV
Species Reactivity:
Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 98% PBS, 2% Sucrose
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.