Cat#:FPA-17583P;Product Name:Rabbit Anti-GNG2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Fusion protein corresponding to Human GNG2 aa 1-71. The identity of the protein fusion partner is GST. Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPL LTPVPASENPFREKKFFCAIL ;Species Reactivity:Mouse, Human Predicted to work with: Cow, Orangutan;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 50% Glycerol, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Fusion protein corresponding to Human GNG2 aa 1-71. The identity of the protein fusion partner is GST. Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPL LTPVPASENPFREKKFFCAIL
Species Reactivity:
Mouse, Human Predicted to work with: Cow, Orangutan