• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-GNG2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-17583P
  • Product Name:
  • Rabbit Anti-GNG2 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Fusion protein corresponding to Human GNG2 aa 1-71. The identity of the protein fusion partner is GST. Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPL LTPVPASENPFREKKFFCAIL
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Cow, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P
  • Storage Buffer:
  • pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 50% Glycerol, 49% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-GNG13 Polyclonal Antibody-FPA-17582P
  • Online Inquiry

    refresh