• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-gm6177 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-17507P
  • Product Name:
  • Rabbit Anti-gm6177 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide derived from a region within internal region aa ( EDSTLVFIADVKANKHQIKQAVKKLYDIDVAKVNTLIQPDGEKKAYVRLA ) of Rat gm6177.
  • Species Reactivity:
  • Rat Predicted to work with: Mouse, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 98% PBS, 2% Sucrose
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Gm5581 Polyclonal Antibody-FPA-17506P
  • Online Inquiry

    refresh