Cat#:FPA-17507P;Product Name:Rabbit Anti-gm6177 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide derived from a region within internal region aa ( EDSTLVFIADVKANKHQIKQAVKKLYDIDVAKVNTLIQPDGEKKAYVRLA ) of Rat gm6177. ;Species Reactivity:Rat Predicted to work with: Mouse, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;