Rabbit Anti-Gm13152 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-17496P

• Product Name:
• Rabbit Anti-Gm13152 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide derived from a region within N terminal aa 1-50 ( MSVFLVNTPQGLLTFKDVAVEFSLEEWERLSFAQRSLCIDVMLENYNNLL ) of Mouse Gm13152 (NM_001039209.2).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Horse, Cow, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid