Rabbit Anti-Glypican 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-17468P

• Product Name:
• Rabbit Anti-Glypican 3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Glypican 3 aa 324-373 (internal sequence). Sequence: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL K

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee

• Isotype:
• IgG

• Application:
• ELISA, IHC-P, ICC/IF, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid