Rabbit Anti-GLE1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-17129P

• Product Name:
• Rabbit Anti-GLE1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal ammino acids 217-266 (LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASE Q) of human GLE1 (NP_001490).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid