Rabbit Anti-GAPDH Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-16511P

• Product Name:
• Rabbit Anti-GAPDH Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide aa 90-140 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: AEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYD N

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid