Rabbit Anti-GAMT Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46901P

• Product Name:
• Rabbit Anti-GAMT Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human GAMT aa 100-150 (internal sequence). The exact sequence is proprietary. (NP_000147.1). Sequence: RDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQF N Database link: Q14353 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8

• Clonality:
• Polyclonal

• Form:
• Liquid