Product finder
Cat#:FPA-16470P;Product Name:Rabbit Anti-Gamma Thrombin Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Gamma Thrombin aa 278-327. The exact sequence is proprietary. NP_000497.1. Sequence: GVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEY QTFFNPR ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Gamma Thrombin Polyclonal Antibody
Online Inquiry
Product Name: Rabbit Anti-Gamma Thrombin Polyclonal Antibody
Immunogen:
Synthetic peptide within Human Gamma Thrombin aa 278-327. The exact sequence is proprietary. NP_000497.1. Sequence: GVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEY QTFFNPR
Species Reactivity:
Human
Storage Buffer:
pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS (without Mg2+, Ca2+)
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
Pre product:Rabbit Anti-Gamma Thrombin Polyclonal Antibody-FPA-16469P
Next product:Rabbit Anti-gamma Tubulin Polyclonal Antibody-FPA-16471P