• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Galanin Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-16346P
  • Product Name:
  • Rabbit Anti-Galanin Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS conjugated to KLH via carboxyl group, corresponding to aa 33-62 of Human Galanin.
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Sheep, Chicken, Cow, Pig, Fish, Macaque monkey
  • Isotype:
  • IgG
  • Application:
  • IP, RIA, ELISA
  • Storage Buffer:
  • Preservative: 0.01% Thimerosal (merthiolate) Constituents: 50% Glycerol, PBS, pH 7.5
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Galanin Polyclonal Antibody-FPA-16345P
  • Online Inquiry

    refresh