Cat#:FPA-16346P;Product Name:Rabbit Anti-Galanin Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS conjugated to KLH via carboxyl group, corresponding to aa 33-62 of Human Galanin. ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Chicken, Cow, Pig, Fish, Macaque monkey;Isotype:IgG;Application:IP, RIA, ELISA;Storage Buffer:Preservative: 0.01% Thimerosal (merthiolate) Constituents: 50% Glycerol, PBS, pH 7.5;Storage Procedures:Store at 4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.;