Rabbit Anti-GAL3ST4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-16329P

• Product Name:
• Rabbit Anti-GAL3ST4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 419-468 ( RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV ) of Mouse GAL3ST4 (NP_001028588).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 97% PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid