Rabbit Anti-GAK Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-16320P

• Product Name:
• Rabbit Anti-GAK Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human GAK aa 101-150. The exact sequence is proprietary. Sequence: FCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLK

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride PBS without Mg2+, Ca2+

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid