Rabbit Anti-GADL1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-16308P

• Product Name:
• Rabbit Anti-GADL1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• antigen sequence: CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPF LVC, corresponding to aa 218-270 of Human GADL1 (Isoform 1).

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Store at -20ºC.

• Clonality:
• Polyclonal

• Form:
• Liquid