Cat#:FPA-16241P;Product Name:Rabbit Anti-GABARAPL1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human GABARAPL1 aa 1-50 (N terminal). Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL ;Species Reactivity:Mouse, Rat, Human Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:ICC/IF, IHC-P, WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;