• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-FRZB Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-15958P
  • Product Name:
  • Rabbit Anti-FRZB Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within internal aa 216-265 (VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEER S) of Human FRZB (NP_001454).
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • IHC-P, WB
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-FRZB Polyclonal Antibody-FPA-15957P
  • Online Inquiry

    refresh