Rabbit Anti-FRZB Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-15958P

• Product Name:
• Rabbit Anti-FRZB Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 216-265 (VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEER S) of Human FRZB (NP_001454).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid