Rabbit Anti-Frizzled 4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-15883P

• Product Name:
• Rabbit Anti-Frizzled 4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Frizzled 4 aa 488-537 (internal sequence). Sequence: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

• Species Reactivity:
• Mouse, Rat, Horse, Dog, Human Predicted to work with: Chicken, Guinea pig, Cow, Cat

• Isotype:
• IgG

• Application:
• ICC/IF, IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid