Cat#:FPA-15869P;Product Name:Rabbit Anti-Frequenin Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Rat Frequenin aa 161-190. Sequence: DGKLTLQEFQEGSKADPSIVQALSLYDGLV ;Species Reactivity:Rat Predicted to work with: Mouse, Chicken, Cow, Human, Xenopus laevis, Drosophila melanogaster;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 0.1% BSA, 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.;