• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Frequenin Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-15869P
  • Product Name:
  • Rabbit Anti-Frequenin Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Rat Frequenin aa 161-190. Sequence: DGKLTLQEFQEGSKADPSIVQALSLYDGLV
  • Species Reactivity:
  • Rat Predicted to work with: Mouse, Chicken, Cow, Human, Xenopus laevis, Drosophila melanogaster
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: 0.05% Sodium azide Constituents: 0.1% BSA, 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-FREM2 Polyclonal Antibody-FPA-15868P
  • Online Inquiry

    refresh