Rabbit Anti-FPGT Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-15834P

• Product Name:
• Rabbit Anti-FPGT Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 344-393 ( TSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIP ) of Human FPGT (NP_003829)

• Species Reactivity:
• Human Predicted to work with: Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid